ACTH (1-39), human,CAS:12279-41-3
ACTH (1-39), human
Product description
Pituitary hormone N-terminal synthetic fragment that stimulates glucocorticoid and mineralocorticoid synthesis and release in the adrenal cortex.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 12279-41-3 |
Sequence | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH/ SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product